CacheBy
Atlas Antibodies Anti-ANXA9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANXA9 Antibody

상품 한눈에 보기

Human ANXA9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 완충액에 보존됨.

카탈로그번호
HPA028404-xxx (2개 옵션)
카테고리
Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028404-100 Anti-ANXA9 Antibody, annexin A9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028404-25 Anti-ANXA9 Antibody, annexin A9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANXA9 Antibody

Anti-ANXA9 Antibody

Target: annexin A9
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human ANXA9.


Alternative Gene Names

  • ANX31

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein annexin A9
Target Gene ANXA9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000015702 (77%), Rat ENSRNOG00000021134 (77%)

Antigen sequence:
NLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGIL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.