CacheBy
Atlas Antibodies Anti-MMP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MMP1 Antibody

상품 한눈에 보기

Human MMP1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 보존용으로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA004920-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004920-100 Anti-MMP1 Antibody, matrix metallopeptidase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004920-25 Anti-MMP1 Antibody, matrix metallopeptidase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MMP1 Antibody

Anti-MMP1 Antibody

Target: matrix metallopeptidase 1 (MMP1)
Type: Polyclonal Antibody against Human MMP1


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human MMP1.
Purified using the PrEST antigen as affinity ligand for high specificity and reproducibility.


Alternative Gene Names

  • CLG

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDH

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Mouse (ENSMUSG00000041620) – 55% identity
    • Rat (ENSRNOG00000032353) – 53% identity

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use; determine optimal concentration per application
Safety Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.