Atlas Antibodies Anti-MMP25 Antibody

상품 한눈에 보기

Human MMP25를 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 높은 특이성과 재현성을 보장. ICC 등 다양한 응용에 적합하며, PBS/glycerol buffer에 보존됨. MMP20, MMPL1 등 유사 단백질과 구분 가능.

카탈로그번호: HPA055640-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055640-100 Anti-MMP25 Antibody, matrix metallopeptidase 25 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055640-25 Anti-MMP25 Antibody, matrix metallopeptidase 25 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MMP25 Antibody

Anti-MMP25 Antibody

Target: Matrix metallopeptidase 25 (MMP25)
Supplier: Atlas Antibodies

Recommended Applications

면역세포화학 (ICC)

Product Description

Polyclonal Antibody against Human MMP25

Alternative Gene Names

MMP20, MMPL1, MT6-MMP

Open Datasheet

Target Information

Target Protein: Matrix metallopeptidase 25
Target Gene: MMP25
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ETFFFKGPWFWRLQPSGQLVSPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLE

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000023903	84%
Rat	ENSRNOG00000023643	50%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet