
원본
Atlas Antibodies Anti-MMP14 Antibody
상품 한눈에 보기
Human MMP14 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 검증되었으며 Mouse, Rat과 99% 서열 동일성 보유.
- 카탈로그번호
- HPA051432-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051432-100 Anti-MMP14 Antibody, matrix metallopeptidase 14 (membrane-inserted) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051432-25 Anti-MMP14 Antibody, matrix metallopeptidase 14 (membrane-inserted) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MMP14 Antibody
Anti-MMP14 Antibody
Target: matrix metallopeptidase 14 (membrane-inserted)
Product Type: Polyclonal Antibody against Human MMP14
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human MMP14 (matrix metallopeptidase 14, membrane-inserted).
Alternative Gene Names
MT1-MMP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | matrix metallopeptidase 14 (membrane-inserted) |
| Target Gene | MMP14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | HWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEG |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000000957 (99%), Rat ENSRNOG00000010947 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



