원본

Atlas Antibodies Anti-MMP14 Antibody

상품 한눈에 보기

Human MMP14 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 검증되었으며 Mouse, Rat과 99% 서열 동일성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051432-100 Anti-MMP14 Antibody, matrix metallopeptidase 14 (membrane-inserted) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051432-25 Anti-MMP14 Antibody, matrix metallopeptidase 14 (membrane-inserted) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: matrix metallopeptidase 14 (membrane-inserted)
Product Type: Polyclonal Antibody against Human MMP14

Polyclonal antibody raised in rabbit against human MMP14 (matrix metallopeptidase 14, membrane-inserted).

MT1-MMP

항목	내용
Target Protein	matrix metallopeptidase 14 (membrane-inserted)
Target Gene	MMP14
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	HWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEG
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000000957 (99%), Rat ENSRNOG00000010947 (99%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand