
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MINK1 Antibody
상품 한눈에 보기
Human MINK1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. 높은 특이성과 재현성을 제공하며, PrEST 항원을 이용해 친화 정제됨.
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056296-100 Anti-MINK1 Antibody, misshapen-like kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056296-25 Anti-MINK1 Antibody, misshapen-like kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MINK1 Antibody
Anti-MINK1 Antibody
Target Protein: misshapen-like kinase 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human MINK1
Alternative Gene Names
B55, MAP4K6, MINK, YSK2, ZC3
Technical Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | misshapen-like kinase 1 |
| Target Gene | MINK1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000020827 (100%), Rat ENSRNOG00000033508 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



