CacheBy
Atlas Antibodies Anti-MINOS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MINOS1 Antibody

상품 한눈에 보기

인간 MINOS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증 완료 및 마우스·랫과의 높은 서열 유사성을 보유합니다.

카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059930-100 Anti-MINOS1 Antibody, mitochondrial inner membrane organizing system 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059930-25 Anti-MINOS1 Antibody, mitochondrial inner membrane organizing system 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MINOS1 Antibody

Anti-MINOS1 Antibody

Target: mitochondrial inner membrane organizing system 1 (MINOS1)
Type: Polyclonal Antibody against Human MINOS1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression by comparison to RNA-seq data in tissues with high and low expression
  • ICC (Immunocytochemistry)

Alternative Gene Names

C1orf151, FLJ36999, MIO10, RP5-1056L3.2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial inner membrane organizing system 1
Target Gene MINOS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Mouse ENSMUSG00000050608 (95%), Rat ENSRNOG00000042696 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.