
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MINOS1 Antibody
상품 한눈에 보기
인간 MINOS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증 완료 및 마우스·랫과의 높은 서열 유사성을 보유합니다.
- 카탈로그번호
- HPA059930-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059930-100 Anti-MINOS1 Antibody, mitochondrial inner membrane organizing system 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059930-25 Anti-MINOS1 Antibody, mitochondrial inner membrane organizing system 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MINOS1 Antibody
Anti-MINOS1 Antibody
Target: mitochondrial inner membrane organizing system 1 (MINOS1)
Type: Polyclonal Antibody against Human MINOS1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression by comparison to RNA-seq data in tissues with high and low expression
- ICC (Immunocytochemistry)
Alternative Gene Names
C1orf151, FLJ36999, MIO10, RP5-1056L3.2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial inner membrane organizing system 1 |
| Target Gene | MINOS1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQE |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000050608 (95%), Rat ENSRNOG00000042696 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.




