Atlas Antibodies Anti-MINPP1 Antibody

상품 한눈에 보기

사람 MINPP1 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 제조되었습니다. 높은 종간 보존성을 가지며, 안정한 PBS/glycerol 버퍼에 보존되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026859-100 Anti-MINPP1 Antibody, multiple inositol-polyphosphate phosphatase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026859-25 Anti-MINPP1 Antibody, multiple inositol-polyphosphate phosphatase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: multiple inositol-polyphosphate phosphatase 1 (MINPP1)
Type: Polyclonal Antibody against Human MINPP1

Polyclonal antibody targeting human MINPP1, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	multiple inositol-polyphosphate phosphatase 1
Target Gene	MINPP1
Verified Species Reactivity	Human
Interspecies Homology	Mouse (83%), Rat (82%)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Safety Data	Material Safety Data Sheet