
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MGST2 Antibody
상품 한눈에 보기
Human MGST2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었으며, 보존용으로 sodium azide가 포함되어 있습니다.
- 카탈로그번호
- HPA010707-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA010707-100 Anti-MGST2 Antibody, microsomal glutathione S-transferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010707-25 Anti-MGST2 Antibody, microsomal glutathione S-transferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MGST2 Antibody
Anti-MGST2 Antibody
Target Protein: microsomal glutathione S-transferase 2 (MGST2)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human MGST2 protein.
Alternative Gene Names
- MGST-II
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000061857 | 76% |
| Mouse | ENSMUSG00000074604 | 73% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



