CacheBy
Atlas Antibodies Anti-MGST2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MGST2 Antibody

상품 한눈에 보기

Human MGST2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었으며, 보존용으로 sodium azide가 포함되어 있습니다.

카탈로그번호
HPA010707-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010707-100 Anti-MGST2 Antibody, microsomal glutathione S-transferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010707-25 Anti-MGST2 Antibody, microsomal glutathione S-transferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MGST2 Antibody

Anti-MGST2 Antibody

Target Protein: microsomal glutathione S-transferase 2 (MGST2)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human MGST2 protein.

Alternative Gene Names

  • MGST-II

Open Datasheet (PDF)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000061857 76%
Mouse ENSMUSG00000074604 73%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.