CacheBy
Atlas Antibodies Anti-MGLL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MGLL Antibody

상품 한눈에 보기

Human MGLL 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존됩니다. 인간 반응성이 검증되었고, 쥐 및 랫과 높은 서열 유사성을 가집니다.

카탈로그번호
HPA011994-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011994-100 Anti-MGLL Antibody, monoglyceride lipase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011994-25 Anti-MGLL Antibody, monoglyceride lipase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MGLL Antibody

Anti-MGLL Antibody

Target Information

  • Target Protein: Monoglyceride lipase
  • Target Gene: MGLL
  • Alternative Gene Names: HU-K5, MGL

Product Description

Polyclonal antibody against human MGLL.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RQHIMETGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSM

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000033174): 84%
    • Rat (ENSRNOG00000014508): 82%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Information

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.