CacheBy
Atlas Antibodies Anti-MGME1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MGME1 Antibody

상품 한눈에 보기

인간 MGME1 단백질에 대한 폴리클로날 항체로, 미토콘드리아 유전체 유지에 관련된 엑소뉴클레아제 연구에 적합. IHC, WB, ICC 등 다양한 응용에 사용 가능. 토끼 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증됨.

카탈로그번호
HPA040913-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040913-100 Anti-MGME1 Antibody, mitochondrial genome maintenance exonuclease 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040913-25 Anti-MGME1 Antibody, mitochondrial genome maintenance exonuclease 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MGME1 Antibody

Anti-MGME1 Antibody

Target: mitochondrial genome maintenance exonuclease 1 (MGME1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MGME1


Alternative Gene Names

bA504H3.4, C20orf72, DDK1

Open Datasheet


Target Information

항목 내용
Target Protein mitochondrial genome maintenance exonuclease 1
Target Gene MGME1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028196 (62%), Mouse ENSMUSG00000027424 (62%)

Antigen Sequence

NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.