CacheBy
Atlas Antibodies Anti-MED26 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED26 Antibody

상품 한눈에 보기

인체 MED26 단백질을 인식하는 고품질 폴리클로날 항체. IHC 기반 정교한 Orthogonal 검증 수행. 인간 반응성 확인 및 RNA-seq 데이터 비교로 신뢰성 강화. 프레스티지 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA057997-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057997-100 Anti-MED26 Antibody, mediator complex subunit 26 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057997-25 Anti-MED26 Antibody, mediator complex subunit 26 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED26 Antibody

Anti-MED26 Antibody

Target: mediator complex subunit 26
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human MED26


Alternative Gene Names

CRSP7, CRSP70

Open Datasheet


Target Information

항목 내용
Target Protein mediator complex subunit 26
Target Gene MED26
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000045248 (88%), Rat ENSRNOG00000012270 (88%)

Antigen Sequence:

PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.