Atlas Antibodies Anti-MDS2 Antibody

상품 한눈에 보기

Human MDS2 단백질을 인식하는 rabbit polyclonal 항체로, myelodysplastic syndrome 2 전좌 관련 단백질 연구에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052999-100 Anti-MDS2 Antibody, myelodysplastic syndrome 2 translocation associated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052999-25 Anti-MDS2 Antibody, myelodysplastic syndrome 2 translocation associated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Myelodysplastic syndrome 2 translocation associated (MDS2)
Type: Polyclonal Antibody against Human MDS2

Rabbit polyclonal antibody raised against human MDS2 protein.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	Myelodysplastic syndrome 2 translocation associated
Target Gene	MDS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLTL
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000049378 (26%), Mouse ENSMUSG00000030313 (26%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.