CacheBy
Atlas Antibodies Anti-MDP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MDP1 Antibody

상품 한눈에 보기

Human MDP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 검증된 신뢰성 높은 항체이며, PrEST 항원을 이용해 Affinity 정제되었습니다. Human에 반응하며 Rat, Mouse와 높은 유사성을 가집니다.

카탈로그번호
HPA003064-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003064-100 Anti-MDP1 Antibody, magnesium-dependent phosphatase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003064-25 Anti-MDP1 Antibody, magnesium-dependent phosphatase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MDP1 Antibody

Anti-MDP1 Antibody

Target: magnesium-dependent phosphatase 1 (MDP1)
Type: Polyclonal Antibody against Human MDP1


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody raised in rabbit, targeting Human MDP1.


Alternative Gene Names

  • FN6Pase
  • MGC5987

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein magnesium-dependent phosphatase 1
Target Gene MDP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQT
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000019840 (88%), Mouse ENSMUSG00000002329 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.