
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MDP1 Antibody
상품 한눈에 보기
Human MDP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation으로 검증된 신뢰성 높은 항체이며, PrEST 항원을 이용해 Affinity 정제되었습니다. Human에 반응하며 Rat, Mouse와 높은 유사성을 가집니다.
- 카탈로그번호
- HPA003064-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003064-100 Anti-MDP1 Antibody, magnesium-dependent phosphatase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003064-25 Anti-MDP1 Antibody, magnesium-dependent phosphatase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MDP1 Antibody
Anti-MDP1 Antibody
Target: magnesium-dependent phosphatase 1 (MDP1)
Type: Polyclonal Antibody against Human MDP1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit, targeting Human MDP1.
Alternative Gene Names
- FN6Pase
- MGC5987
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | magnesium-dependent phosphatase 1 |
| Target Gene | MDP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQT |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000019840 (88%), Mouse ENSMUSG00000002329 (85%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



