CacheBy
Atlas Antibodies Anti-MDH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MDH2 Antibody

상품 한눈에 보기

인간 MDH2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. siRNA 유전자 검증 및 독립 항체 기반 IHC 검증 완료. 고순도 Affinity 정제, PBS/glycerol buffer로 안정화되어 있습니다.

카탈로그번호
HPA019716-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019716-100 Anti-MDH2 Antibody, malate dehydrogenase 2, NAD (mitochondrial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019716-25 Anti-MDH2 Antibody, malate dehydrogenase 2, NAD (mitochondrial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MDH2 Antibody

Anti-MDH2 Antibody

Target: malate dehydrogenase 2, NAD (mitochondrial)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Validated for immunocytochemistry.

Product Description

Polyclonal antibody against Human MDH2.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein malate dehydrogenase 2, NAD (mitochondrial)
Target Gene MDH2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM

Species Reactivity

항목 내용
Verified Species Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000019179 (98%), Rat ENSRNOG00000001440 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
IHC Tooltip
WB Genetic Validation
WB Tooltip
ICC Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.