CacheBy
Atlas Antibodies Anti-MDH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MDH2 Antibody

상품 한눈에 보기

인간 MDH2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 검증된 신뢰성 높은 시약입니다. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인간, 마우스, 랫트에 반응하며 유전자 및 독립 항체 검증 완료.

카탈로그번호
HPA026720-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026720-100 Anti-MDH2 Antibody, malate dehydrogenase 2, NAD (mitochondrial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026720-25 Anti-MDH2 Antibody, malate dehydrogenase 2, NAD (mitochondrial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MDH2 Antibody

Anti-MDH2 Antibody

Target: malate dehydrogenase 2, NAD (mitochondrial)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human MDH2.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein malate dehydrogenase 2, NAD (mitochondrial)
Target Gene MDH2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000019179 (98%), Rat ENSRNOG00000001440 (98%)

Antigen Sequence:

VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.