CacheBy
Atlas Antibodies Anti-MCPH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCPH1 Antibody

상품 한눈에 보기

인간 MCPH1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. BRIT1 등 대체 유전자명으로도 알려진 microcephalin 1을 타깃으로 하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응합니다.

카탈로그번호
HPA008238-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008238-100 Anti-MCPH1 Antibody, microcephalin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008238-25 Anti-MCPH1 Antibody, microcephalin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCPH1 Antibody

Anti-MCPH1 Antibody

Target Protein: microcephalin 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human MCPH1.


Alternative Gene Names

  • BRIT1
  • FLJ12847

Open Datasheet


Target Information

항목 내용
Target Protein microcephalin 1
Target Gene MCPH1
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000039842 (55%), Rat ENSRNOG00000028586 (52%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGI

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.