CacheBy
Atlas Antibodies Anti-MCOLN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCOLN2 Antibody

상품 한눈에 보기

Human MCOLN2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 특이적으로 반응하며, 안정적인 PBS/glycerol buffer로 보존됨.

카탈로그번호
HPA048999-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048999-100 Anti-MCOLN2 Antibody, mucolipin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048999-25 Anti-MCOLN2 Antibody, mucolipin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCOLN2 Antibody

Anti-MCOLN2 Antibody

Target Protein: mucolipin 2 (MCOLN2)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MCOLN2, generated in rabbit.

Alternative Gene Names

  • FLJ36691
  • TRP-ML2
  • TRPML2

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000011008 70%
Rat ENSRNOG00000015089 66%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.