
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAP4K5 Antibody
상품 한눈에 보기
Human MAP4K5 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. GCKR/KHS1 등 대체 유전자명과 교차 반응 정보 포함.
- 카탈로그번호
- HPA036696-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036696-100 Anti-MAP4K5 Antibody, mitogen-activated protein kinase kinase kinase kinase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036696-25 Anti-MAP4K5 Antibody, mitogen-activated protein kinase kinase kinase kinase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAP4K5 Antibody
Anti-MAP4K5 Antibody
Target: mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)
Type: Polyclonal Antibody against Human MAP4K5
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human MAP4K5, purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
GCKR, KHS, KHS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitogen-activated protein kinase kinase kinase kinase 5 |
| Target Gene | MAP4K5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPKPA |
| Verified Species Reactivity | Human |
| Interspecies Ortholog Identity | Mouse: 87% (ENSMUSG00000034761), Rat: 82% (ENSRNOG00000004923) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



