AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAP3K9 Antibody
상품 한눈에 보기
Human MAP3K9 단백질을 인식하는 고품질 폴리클로날 항체로 IHC 및 ICC 응용에 적합. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. Human에 반응성이 검증되었으며 안정적인 PBS/glycerol buffer에 보존.
- 카탈로그번호
- HPA000942-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000942-100 Anti-MAP3K9 Antibody, mitogen-activated protein kinase kinase kinase 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000942-25 Anti-MAP3K9 Antibody, mitogen-activated protein kinase kinase kinase 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAP3K9 Antibody
Anti-MAP3K9 Antibody
Target: Mitogen-activated protein kinase kinase kinase 9 (MAP3K9)
Type: Polyclonal Antibody against Human MAP3K9
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Alternative Gene Names
- MEKK9
- MLK1
- PRKE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitogen-activated protein kinase kinase kinase 9 |
| Target Gene | MAP3K9 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007271 (95%), Mouse ENSMUSG00000042724 (76%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | EGSPQRREKANGLSTPSESPHFHLGLKSLVDGYKQWSSSAPNLVKGPRSSPALPGFTSLMEMEDEDSEGPGSGESRLQHSPSQSYLCIPFPRGEDGDGPSSDGIHEEPTPVNSATSTPQLTPTNSLKRGG |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.