
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAP3K14 Antibody
상품 한눈에 보기
Human MAP3K14 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 발현 검증을 거쳤으며, Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과 92% 유사성을 가집니다.
- 카탈로그번호
- HPA027269-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027269-100 Anti-MAP3K14 Antibody, mitogen-activated protein kinase kinase kinase 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027269-25 Anti-MAP3K14 Antibody, mitogen-activated protein kinase kinase kinase 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAP3K14 Antibody
Anti-MAP3K14 Antibody
mitogen-activated protein kinase kinase kinase 14
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MAP3K14
Alternative Gene Names
FTDCR1B, HS, HSNIK, NIK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitogen-activated protein kinase kinase kinase 14 |
| Target Gene | MAP3K14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SVYKLEAVEKSPVFCGKWEILNDVITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNVAHA |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity to orthologs: Rat ENSRNOG00000003278 (92%), Mouse ENSMUSG00000020941 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



