
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAP3K13 Antibody
상품 한눈에 보기
Human MAP3K13 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합. LZK/MEKK13 대체명으로도 알려짐. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간 시료에 검증됨.
- 카탈로그번호
- HPA016497-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016497-100 Anti-MAP3K13 Antibody, mitogen-activated protein kinase kinase kinase 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016497-25 Anti-MAP3K13 Antibody, mitogen-activated protein kinase kinase kinase 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAP3K13 Antibody
Anti-MAP3K13 Antibody
mitogen-activated protein kinase kinase kinase 13 (MAP3K13)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MAP3K13.
Alternative Gene Names
LZK, MEKK13
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitogen-activated protein kinase kinase kinase 13 |
| Target Gene | MAP3K13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033618 (87%), Rat ENSRNOG00000025423 (83%) |
Clonality and Host
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
KKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSEGIPTTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAILKNQPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQP제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



