CacheBy
Atlas Antibodies Anti-MAP1S Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP1S Antibody

상품 한눈에 보기

인간 MAP1S 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증된 반응성을 가지며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.

카탈로그번호
HPA050934-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050934-100 Anti-MAP1S Antibody, microtubule-associated protein 1S 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050934-25 Anti-MAP1S Antibody, microtubule-associated protein 1S 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP1S Antibody

Anti-MAP1S Antibody

Target Information

  • Target Protein: microtubule-associated protein 1S
  • Target Gene: MAP1S
  • Alternative Gene Names: BPY2IP1, C19orf5, FLJ10669, MAP8, VCY2IP1
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MAP1S.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000018781 (62%)
  • Mouse ENSMUSG00000019261 (59%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Additional Information

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.