Atlas Antibodies Anti-MAP1B Antibody
상품 한눈에 보기
인간 MAP1B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 유전학적 검증을 통해 높은 특이성과 신뢰성을 확보. PrEST 항원을 이용한 친화 정제 방식으로 제조됨. 다양한 조직 연구 및 단백질 발현 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP1B Antibody
Target: microtubule-associated protein 1B (MAP1B)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Genetic validation): Validation by siRNA knockdown.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against human MAP1B.
Alternative Gene Names
MAP5, PPP1R102
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule-associated protein 1B |
| Target Gene | MAP1B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTST |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000017428 (86%), Mouse ENSMUSG00000052727 (85%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-MAP1S Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAP1LC3A Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAP1B Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAP1S Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAP1LC3B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.