CacheBy
Atlas Antibodies Anti-MANEAL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MANEAL Antibody

상품 한눈에 보기

Human MANEAL 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며 Human, Mouse, Rat에 반응.

카탈로그번호
HPA063423-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063423-100 Anti-MANEAL Antibody, mannosidase, endo-alpha-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063423-25 Anti-MANEAL Antibody, mannosidase, endo-alpha-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MANEAL Antibody

Anti-MANEAL Antibody

Target Information

  • Protein: mannosidase, endo-alpha-like
  • Gene: MANEAL
  • Alternative Gene Name: FLJ31434

Product Description

Polyclonal antibody against Human MANEAL.

면역세포화학 (ICC)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    FYYSWYGSPRREGHYIHWDHVMVPHWDPKISASY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000042763 (100%)
  • Rat ENSRNOG00000025349 (100%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Storage Note Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.