CacheBy
Atlas Antibodies Anti-MANBA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MANBA Antibody

상품 한눈에 보기

Human MANBA 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% glycerol 기반 PBS buffer에 보존됩니다. 사람에 특이적으로 반응하며, 마우스 및 랫트와도 유사성이 있습니다.

카탈로그번호
HPA053478-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053478-100 Anti-MANBA Antibody, mannosidase, beta A, lysosomal 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053478-25 Anti-MANBA Antibody, mannosidase, beta A, lysosomal 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MANBA Antibody

Anti-MANBA Antibody

Target: mannosidase, beta A, lysosomal
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human MANBA.

Open Datasheet


Target Information

항목 내용
Target Protein Mannosidase, beta A, lysosomal
Target Gene MANBA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFSDNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTS

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Mouse (ENSMUSG00000028164): 75%
    • Rat (ENSRNOG00000052247): 72%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.