CacheBy
Thermo Fisher Scientific MAK Polyclonal Antibody
원본

Thermo Fisher Scientific MAK Polyclonal Antibody

상품 한눈에 보기

인간 MAK 단백질의 C-말단 서열을 기반으로 한 Rabbit Polyclonal Antibody. Western blot에 적합하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 23. 오전 10:39
Thermo Fisher Scientific PA579621 MAK Polyclonal Antibody 100 ug pk판매 단위 pk
재고 1개
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific MAK Polyclonal Antibody

Applications

  • Western Blot (WB): 0.1–0.5 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588–623aa RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Wet ice
RRID AB_2746736

Product Specific Information

  • 재구성: 증류수 0.2 mL로 재구성 시 최종 농도 500 µg/mL

Target Information

MAK 유전자는 세포 주기 조절에 관여하는 세린/트레오닌 단백질 키나아제와 관련이 있습니다. 주로 고환의 생식세포에서 발현되며, 감수분열 동안 염색체의 시냅토넬 복합체에 위치합니다. 일부 연구에서는 감각 상피 발달 과정에서도 높은 발현이 보고되어 보다 일반적인 기능을 가질 가능성이 제시되었습니다.


For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.