
1 / 2
Atlas Antibodies Anti-ANKLE2 Antibody
상품 한눈에 보기
인간 ANKLE2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Western blot 등 다양한 연구 응용에 적합하며, 높은 종간 보존성을 보입니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ANKLE2 Antibody
Target: ankyrin repeat and LEM domain containing 2
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
Product Description
Polyclonal antibody against Human ANKLE2.
Alternative Gene Names
- KIAA0692
- Lem4
- LEMD7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ankyrin repeat and LEM domain containing 2 |
| Target Gene | ANKLE2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000029501 (91%), Rat ENSRNOG00000060144 (90%) |
Clonality and Host
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ANKMY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANKMY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANKLE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANKK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANKIB1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.