CacheBy
Atlas Antibodies Anti-ANKLE2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANKLE2 Antibody

상품 한눈에 보기

인간 ANKLE2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Western blot 등 다양한 연구 응용에 적합하며, 높은 종간 보존성을 보입니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다.

카탈로그번호
HPA003602-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003602-100 Anti-ANKLE2 Antibody, ankyrin repeat and LEM domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003602-25 Anti-ANKLE2 Antibody, ankyrin repeat and LEM domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANKLE2 Antibody

Anti-ANKLE2 Antibody

Target: ankyrin repeat and LEM domain containing 2
Supplier: Atlas Antibodies


  • Western Blot (WB)

Product Description

Polyclonal antibody against Human ANKLE2.


Alternative Gene Names

  • KIAA0692
  • Lem4
  • LEMD7

Open Datasheet


Target Information

항목 내용
Target Protein ankyrin repeat and LEM domain containing 2
Target Gene ANKLE2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029501 (91%), Rat ENSRNOG00000060144 (90%)

Clonality and Host

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.