CacheBy
Atlas Antibodies Anti-ANKK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANKK1 Antibody

상품 한눈에 보기

Human ANKK1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합. ANKK1 유전자(X-kinase) 표적. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 가짐.

카탈로그번호
HPA012813-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012813-100 Anti-ANKK1 Antibody, ankyrin repeat and kinase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012813-25 Anti-ANKK1 Antibody, ankyrin repeat and kinase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANKK1 Antibody

Anti-ANKK1 Antibody

Target: ankyrin repeat and kinase domain containing 1 (ANKK1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ANKK1.


Alternative Gene Names

  • X-kinase

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ankyrin repeat and kinase domain containing 1
Target Gene ANKK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000025037 77%
Mouse ENSMUSG00000032257 74%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.