CacheBy
Atlas Antibodies Anti-AMFR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AMFR Antibody

상품 한눈에 보기

Human AMFR 단백질을 인식하는 Rabbit Polyclonal 항체로, E3 유비퀴틴 단백질 리가아제 연구용. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 정제됨. 고순도 및 높은 종 특이성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA077835-100 Anti-AMFR Antibody, autocrine motility factor receptor, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077835-25 Anti-AMFR Antibody, autocrine motility factor receptor, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AMFR Antibody

Anti-AMFR Antibody

Target: autocrine motility factor receptor (E3 ubiquitin protein ligase)
Type: Polyclonal Antibody against Human AMFR


  • Immunohistochemistry (IHC)

Product Description

This polyclonal antibody is generated in rabbit against human AMFR (autocrine motility factor receptor), also known as E3 ubiquitin protein ligase.


Alternative Gene Names

  • gp78
  • RNF45

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Autocrine motility factor receptor, E3 ubiquitin protein ligase
Target Gene AMFR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031751 (99%), Rat ENSRNOG00000055446 (99%)

Antigen Sequence (PrEST):

VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.