
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AMER1 Antibody
상품 한눈에 보기
인간 AMER1 단백질을 표적으로 하는 폴리클로날 토끼 항체로, Affinity 정제 방식으로 제조되었습니다. 다양한 응용 분야에 적합하며, 높은 특이성과 재현성을 제공합니다. 버퍼는 PBS와 글리세롤 기반으로 안정성을 유지합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA065265-100 Anti-AMER1 Antibody, APC membrane recruitment protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065265-25 Anti-AMER1 Antibody, APC membrane recruitment protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AMER1 Antibody
Anti-AMER1 Antibody
Target Protein: APC membrane recruitment protein 1
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal Antibody against Human AMER1
Alternative Gene Names
FAM123B, FLJ39827, RP11-403E24.2, WTX
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | APC membrane recruitment protein 1 |
| Target Gene | AMER1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RDSPLSLYTEPPGAYDWPAWAPCPLPVGPGPAWISPNQLDRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQLARPSHLHLP |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity (%) |
|---|---|---|
| Rat | ENSRNOG00000007984 | 69% |
| Mouse | ENSMUSG00000050332 | 69% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



