CacheBy
Atlas Antibodies Anti-ALS2CR12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALS2CR12 Antibody

상품 한눈에 보기

Human ALS2CR12 단백질을 인식하는 토끼 폴리클로날 항체입니다. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공합니다. 면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다. 40% glycerol PBS buffer에 보존되어 안정적입니다.

카탈로그번호
HPA035793-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035793-100 Anti-ALS2CR12 Antibody, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035793-25 Anti-ALS2CR12 Antibody, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALS2CR12 Antibody

Anti-ALS2CR12 Antibody

Target: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Supplier: Atlas Antibodies


면역세포화학 (ICC)


Product Description

Polyclonal Antibody against Human ALS2CR12

Open Datasheet


Target Information

항목 내용
Target Protein amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Target Gene ALS2CR12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000024917 (73%), Mouse ENSMUSG00000047528 (67%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Antigen Sequence

HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.