
1 / 2
Atlas Antibodies Anti-ALS2CR12 Antibody
상품 한눈에 보기
Human ALS2CR12 단백질을 인식하는 토끼 폴리클로날 항체입니다. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공합니다. 면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다. 40% glycerol PBS buffer에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ALS2CR12 Antibody
Target: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal Antibody against Human ALS2CR12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12 |
| Target Gene | ALS2CR12 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000024917 (73%), Mouse ENSMUSG00000047528 (67%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Antigen Sequence
HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNRNotes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ALS2CL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALX3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALS2CR12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALPP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.