CacheBy
Atlas Antibodies Anti-ALS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALS2 Antibody

상품 한눈에 보기

휴먼 ALS2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, ALS2 관련 연구에 유용합니다.

카탈로그번호
HPA046588-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046588-100 Anti-ALS2 Antibody, amyotrophic lateral sclerosis 2 (juvenile) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046588-25 Anti-ALS2 Antibody, amyotrophic lateral sclerosis 2 (juvenile) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALS2 Antibody

Anti-ALS2 Antibody

Target: amyotrophic lateral sclerosis 2 (juvenile)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ALS2 protein.


Alternative Gene Names

  • ALS2CR6

Open Datasheet (PDF)


Target Information

  • Target Protein: amyotrophic lateral sclerosis 2 (juvenile)
  • Target Gene: ALS2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000023280 91%
Mouse ENSMUSG00000026024 91%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.