CacheBy
Atlas Antibodies Anti-ALS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALS2 Antibody

상품 한눈에 보기

휴먼 ALS2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, ALS2 관련 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046588-100 Anti-ALS2 Antibody, amyotrophic lateral sclerosis 2 (juvenile) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046588-25 Anti-ALS2 Antibody, amyotrophic lateral sclerosis 2 (juvenile) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALS2 Antibody

Anti-ALS2 Antibody

Target: amyotrophic lateral sclerosis 2 (juvenile)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ALS2 protein.


Alternative Gene Names

  • ALS2CR6

Open Datasheet (PDF)


Target Information

  • Target Protein: amyotrophic lateral sclerosis 2 (juvenile)
  • Target Gene: ALS2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000023280 91%
Mouse ENSMUSG00000026024 91%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.