CacheBy
Atlas Antibodies Anti-ALKBH7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALKBH7 Antibody

상품 한눈에 보기

Human ALKBH7 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 대해 검증되었습니다. 40% glycerol/PBS buffer로 안정화되어 장기 보관이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039872-100 Anti-ALKBH7 Antibody, alkB, alkylation repair homolog 7 (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039872-25 Anti-ALKBH7 Antibody, alkB, alkylation repair homolog 7 (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALKBH7 Antibody

Anti-ALKBH7 Antibody

Product Description

Polyclonal Antibody against Human ALKBH7 (alkB homolog 7)

Immunocytochemistry (ICC)

Alternative Gene Names

MGC10974, SPATA11

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein alkB homolog 7
Target Gene ALKBH7
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000047089 (87%), Mouse ENSMUSG00000002661 (87%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.