
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ALKBH7 Antibody
상품 한눈에 보기
Human ALKBH7 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 대해 검증되었습니다. 40% glycerol/PBS buffer로 안정화되어 장기 보관이 가능합니다.
- 카탈로그번호
- HPA039872-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039872-100 Anti-ALKBH7 Antibody, alkB, alkylation repair homolog 7 (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039872-25 Anti-ALKBH7 Antibody, alkB, alkylation repair homolog 7 (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ALKBH7 Antibody
Anti-ALKBH7 Antibody
Product Description
Polyclonal Antibody against Human ALKBH7 (alkB homolog 7)
Recommended Applications
Immunocytochemistry (ICC)
Alternative Gene Names
MGC10974, SPATA11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alkB homolog 7 |
| Target Gene | ALKBH7 |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000047089 (87%), Mouse ENSMUSG00000002661 (87%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPP |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



