원본

Atlas Antibodies Anti-ALKBH3 Antibody

상품 한눈에 보기

Human ALKBH3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질 발현 검증 완료. PrEST 항원으로 친화 정제되었으며, PBS/glycerol buffer에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA009674-100 Anti-ALKBH3 Antibody, alkB, alkylation repair homolog 3 (E. coli) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA009674-25 Anti-ALKBH3 Antibody, alkB, alkylation repair homolog 3 (E. coli) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: alkB, alkylation repair homolog 3 (E. coli)
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB) – Recombinant expression validation using target protein overexpression
Immunocytochemistry (ICC)

Polyclonal antibody against Human ALKBH3.

항목	내용
Target Protein	alkB, alkylation repair homolog 3 (E. coli)
Target Gene	ALKBH3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000021678 (79%), Mouse ENSMUSG00000040174 (78%)

Antigen Sequence:

WAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGEL

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)