
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ALK Antibody
상품 한눈에 보기
인간 ALK(anaplastic lymphoma receptor tyrosine kinase)에 특이적인 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, Rabbit IgG 형태로 제공됩니다. PrEST 항원으로 친화 정제되었으며, 인간에 대한 반응성이 검증되었습니다.
- 카탈로그번호
- HPA010694-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA010694-100 Anti-ALK Antibody, anaplastic lymphoma receptor tyrosine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010694-25 Anti-ALK Antibody, anaplastic lymphoma receptor tyrosine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ALK Antibody
Anti-ALK Antibody
Target: Anaplastic lymphoma receptor tyrosine kinase
Type: Polyclonal Antibody against Human ALK
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human ALK (anaplastic lymphoma receptor tyrosine kinase).
Alternative Gene Names
- CD246
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS
Target Details
| 항목 | 내용 |
|---|---|
| Target Protein | Anaplastic lymphoma receptor tyrosine kinase |
| Target Gene | ALK |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000055471 (84%), Rat ENSRNOG00000008683 (83%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.




