CacheBy
Atlas Antibodies Anti-ALKBH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALKBH1 Antibody

상품 한눈에 보기

인간 ALKBH1 단백질에 대한 폴리클로날 항체로, IHC 및 Western blot에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다. Human에 반응성이 검증되었으며 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044087-100 Anti-ALKBH1 Antibody, alkB, alkylation repair homolog 1 (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044087-25 Anti-ALKBH1 Antibody, alkB, alkylation repair homolog 1 (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALKBH1 Antibody

Anti-ALKBH1 Antibody

Target: alkB, alkylation repair homolog 1 (E. coli)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human ALKBH1.

Alternative Gene Names

ABH, alkB, ALKBH, hABH

Open Datasheet

Target Information

  • Target Protein: alkB, alkylation repair homolog 1 (E. coli)
  • Target Gene: ALKBH1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012264 (74%)
  • Mouse ENSMUSG00000079036 (74%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.