
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AHSG Antibody
상품 한눈에 보기
인간 AHSG(alpha-2-HS-glycoprotein)을 표적으로 하는 폴리클로날 항체. 독립 항체 비교를 통한 IHC 검증 및 siRNA knockdown 기반 WB 유전적 검증 지원. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 다양한 응용에 적합한 고품질 연구용 시약.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001524-100 Anti-AHSG Antibody, alpha-2-HS-glycoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001524-25 Anti-AHSG Antibody, alpha-2-HS-glycoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AHSG Antibody
Anti-AHSG Antibody
Target Protein: alpha-2-HS-glycoprotein
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against human AHSG (alpha-2-HS-glycoprotein).
Alternative Gene Names
A2HS, FETUA, HSGA
Specifications
| 항목 | 내용 |
|---|---|
| Target Gene | AHSG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022868 (47%), Rat ENSRNOG00000038370 (43%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



