Atlas Antibodies Anti-AHSG Antibody

상품 한눈에 보기

인간 AHSG(alpha-2-HS-glycoprotein)을 표적으로 하는 폴리클로날 항체. 독립 항체 비교를 통한 IHC 검증 및 siRNA knockdown 기반 WB 유전적 검증 지원. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 다양한 응용에 적합한 고품질 연구용 시약.

카탈로그번호: HPA001524-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001524-100 Anti-AHSG Antibody, alpha-2-HS-glycoprotein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001524-25 Anti-AHSG Antibody, alpha-2-HS-glycoprotein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AHSG Antibody

Anti-AHSG Antibody

Target Protein: alpha-2-HS-glycoprotein
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
ICC: Immunocytochemistry application supported.

Product Description

Polyclonal antibody against human AHSG (alpha-2-HS-glycoprotein).

Alternative Gene Names

A2HS, FETUA, HSGA

Open Datasheet (PDF)

Specifications

항목	내용
Target Gene	AHSG
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPS
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000022868 (47%), Rat ENSRNOG00000038370 (43%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.