CacheBy
Atlas Antibodies Anti-AHSG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AHSG Antibody

상품 한눈에 보기

Human AHSG(alpha-2-HS-glycoprotein)을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 비교 및 siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원을 이용해 친화 정제된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001525-100 Anti-AHSG Antibody, alpha-2-HS-glycoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001525-25 Anti-AHSG Antibody, alpha-2-HS-glycoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AHSG Antibody

Anti-AHSG Antibody

Target Protein: alpha-2-HS-glycoprotein
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal antibody against human AHSG.


Alternative Gene Names

A2HS, FETUA, HSGA


Target Information

항목 내용
Target Protein alpha-2-HS-glycoprotein
Target Gene AHSG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (47%), Rat (43%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Antigen Sequence

LPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPS

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.