CacheBy
Atlas Antibodies Anti-LSAMP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LSAMP Antibody

상품 한눈에 보기

인간 LSAMP 단백질을 인식하는 폴리클로날 항체로, 신경계 관련 연구에 적합합니다. 토끼에서 생산된 IgG 형식이며, 높은 종간 반응성(인간·마우스·랫 100%)을 보입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076122-100 Anti-LSAMP Antibody, limbic system-associated membrane protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076122-25 Anti-LSAMP Antibody, limbic system-associated membrane protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LSAMP Antibody

Anti-LSAMP Antibody

Target: Limbic system-associated membrane protein (LSAMP)
Supplier: Atlas Antibodies


면역세포화학(ICC) 등 다양한 실험 응용에 적합합니다.

OCR 텍스트 (이미지에서 추출됨):
Recommended for ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against human LSAMP.


Alternative Gene Names

IGLON3, LAMP

Open Datasheet


Target Information

항목 내용
Target Protein Limbic system-associated membrane protein
Target Gene LSAMP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000061080 (100%), Rat ENSRNOG00000031852 (100%)

Antigen Sequence:

NYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSAN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자 실험 환경에 따라 결정하십시오.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.