CacheBy
Atlas Antibodies Anti-LSG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LSG1 Antibody

상품 한눈에 보기

Human LSG1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, Human, Mouse, Rat에 반응합니다. PBS/glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037704-100 Anti-LSG1 Antibody, large 60S subunit nuclear export GTPase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037704-25 Anti-LSG1 Antibody, large 60S subunit nuclear export GTPase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LSG1 Antibody

Anti-LSG1 Antibody

Target: large 60S subunit nuclear export GTPase 1 (LSG1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Independent antibody validation
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human LSG1


Alternative Gene Names

  • FLJ11301

Open Datasheet


Target Information

항목 내용
Target Protein large 60S subunit nuclear export GTPase 1
Target Gene LSG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000022538 (92%)
  • Rat ENSRNOG00000001727 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent Validation
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.