AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRTM2 Antibody
상품 한눈에 보기
인간 LRTM2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며 PrEST 항원으로 친화 정제됨. 높은 종간 반응성(마우스 96%, 랫 93%)을 보유. 안정적인 PBS/glycerol 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055094-100 Anti-LRTM2 Antibody, leucine-rich repeats and transmembrane domains 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055094-25 Anti-LRTM2 Antibody, leucine-rich repeats and transmembrane domains 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRTM2 Antibody
Anti-LRTM2 Antibody
Target: leucine-rich repeats and transmembrane domains 2 (LRTM2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human LRTM2.
Target Information
- Target Protein: leucine-rich repeats and transmembrane domains 2
- Target Gene: LRTM2
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
NNSIRTLDRDLLRHSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFKHWME
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000055003 | 96% |
| Rat | ENSRNOG00000007508 | 93% |
Antibody Characteristics
| Attribute | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Concentration / Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.