Atlas Antibodies Anti-LRRN4CL Antibody

상품 한눈에 보기

인간 LRRN4CL 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 단백질 발현을 정밀하게 확인 가능. Rabbit에서 생산된 IgG 항체이며, 고순도 친화 정제 방식으로 제조. Human에 특이적 반응성을 보이며 연구용으로 최적화됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050317-100 Anti-LRRN4CL Antibody, LRRN4 C-terminal like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050317-25 Anti-LRRN4CL Antibody, LRRN4 C-terminal like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

LRRN4 C-terminal like

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal Antibody against Human LRRN4CL

항목	내용
Target Protein	LRRN4 C-terminal like
Target Gene	LRRN4CL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPCKELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCA
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000071656 (67%), Rat ENSRNOG00000026302 (63%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand