CacheBy
Atlas Antibodies Anti-LRRC9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC9 Antibody

상품 한눈에 보기

인간 LRRC9 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식. 높은 종간 보존성(쥐·랫드 86%). 40% 글리세롤/PBS 완충액에 보존제 포함.

카탈로그번호
HPA041381-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041381-100 Anti-LRRC9 Antibody, leucine rich repeat containing 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041381-25 Anti-LRRC9 Antibody, leucine rich repeat containing 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC9 Antibody

Anti-LRRC9 Antibody

Target: leucine rich repeat containing 9 (LRRC9)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human LRRC9.


Alternative Gene Names

  • FLJ46156

Open Datasheet (PDF)


Target Information

  • Target Protein: leucine rich repeat containing 9
  • Target Gene: LRRC9

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SFKELTNLTRLPCLKDLCLNDPQYTTNPVCLLCNYSTHVLYHLPCLQRFDTLDVSAKQIKELADTTAMKKIMYYNMRIKTLQRHLKEDLEKLNDQKCKLQKLPE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000005409 86%
Mouse ENSMUSG00000021090 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.