CacheBy
Atlas Antibodies Anti-LRRC8E Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC8E Antibody

상품 한눈에 보기

Human LRRC8E 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 연구용 응용에 적합하며, 높은 종간 보존성을 보임. 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020466-100 Anti-LRRC8E Antibody, leucine rich repeat containing 8 family, member E 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020466-25 Anti-LRRC8E Antibody, leucine rich repeat containing 8 family, member E 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC8E Antibody

Anti-LRRC8E Antibody

Target: leucine rich repeat containing 8 family, member E (LRRC8E)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human LRRC8E


Alternative Gene Names

  • FLJ23420

Open Datasheet


Target Information

항목 내용
Target Protein leucine rich repeat containing 8 family, member E
Target Gene LRRC8E
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028460 (89%), Mouse ENSMUSG00000046589 (88%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KLRQKLQRNAAGRLELALCMLPGLPDTVFELSEVESLRLEAICDITFPPGLSQLVHLQELSLLHSPARLPFSLQVFLRDHLKVMRVKCEELREVPLWVFGLRGLEELHLEGLFPQELARAATL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.