CacheBy
Atlas Antibodies Anti-LPAR4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LPAR4 Antibody

상품 한눈에 보기

Human LPAR4 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포 염색 등에 적합. GPR23, LPA4 등 다양한 유전자명과 교차 반응. 정제된 IgG 형태로 제공되며, PBS와 글리세롤 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046563-100 Anti-LPAR4 Antibody, lysophosphatidic acid receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046563-25 Anti-LPAR4 Antibody, lysophosphatidic acid receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LPAR4 Antibody

Anti-LPAR4 Antibody

Target: lysophosphatidic acid receptor 4 (LPAR4)
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LPAR4.

Alternative Gene Names

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein lysophosphatidic acid receptor 4
Target Gene LPAR4
Verified Species Reactivity Human
Interspecies Identity Rat (96%), Mouse (96%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.