
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LOXL2 Antibody
상품 한눈에 보기
인간 LOXL2 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. 면역형광(ICC) 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었고, 글리세롤 및 PBS 완충액에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056542-100 Anti-LOXL2 Antibody, lysyl oxidase-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056542-25 Anti-LOXL2 Antibody, lysyl oxidase-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LOXL2 Antibody
Anti-LOXL2 Antibody
Target Information
- Target Protein: Lysyl oxidase-like 2
- Target Gene: LOXL2
- Alternative Gene Names: WS9-14
Product Description
Polyclonal antibody against human LOXL2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000034205): 87%
- Rat (ENSRNOG00000016758): 86%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | ICC (Immunocytochemistry) |
| Storage | Store at -20°C; avoid repeated freeze-thaw cycles |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.


