Atlas Antibodies Anti-LOXL2 Antibody

상품 한눈에 보기

인간 LOXL2 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. 면역형광(ICC) 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었고, 글리세롤 및 PBS 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056542-100 Anti-LOXL2 Antibody, lysyl oxidase-like 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056542-25 Anti-LOXL2 Antibody, lysyl oxidase-like 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human LOXL2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	ICC (Immunocytochemistry)
Storage	Store at -20°C; avoid repeated freeze-thaw cycles
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.