Atlas Antibodies Anti-LMBR1 Antibody

상품 한눈에 보기

Human LMBR1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫드)을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA016592-100 Anti-LMBR1 Antibody, limb development membrane protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA016592-25 Anti-LMBR1 Antibody, limb development membrane protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LMBR1 Antibody

Anti-LMBR1 Antibody

Target: Limb development membrane protein 1 (LMBR1)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LMBR1.

Alternative Gene Names

ACHP, C7orf2, FLJ11665, ZRS

Open Datasheet (PDF)

Target Information

Target Protein: Limb development membrane protein 1
Target Gene: LMBR1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000010721): 93%
Rat (ENSRNOG00000059589): 93%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)