
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LMAN2L Antibody
상품 한눈에 보기
Human LMAN2L 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에 반응하며, 안정적인 PBS/glycerol buffer에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026600-100 Anti-LMAN2L Antibody, lectin, mannose-binding 2-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026600-25 Anti-LMAN2L Antibody, lectin, mannose-binding 2-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LMAN2L Antibody
Anti-LMAN2L Antibody
Target: lectin, mannose-binding 2-like (LMAN2L)
Type: Polyclonal Antibody against Human LMAN2L
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Product Description
Polyclonal antibody raised in rabbit against human LMAN2L (lectin, mannose-binding 2-like).
Alternative Gene Names
- DKFZp564L2423
- VIPL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lectin, mannose-binding 2-like |
| Target Gene | LMAN2L |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | RVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLP |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity:
- Mouse ENSMUSG00000001143 (93%)
- Rat ENSRNOG00000015699 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



