CacheBy
Atlas Antibodies Anti-LIX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIX1 Antibody

상품 한눈에 보기

Human LIX1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐. 40% 글리세롤 및 PBS 완충액에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058426-100 Anti-LIX1 Antibody, Lix1 homolog (chicken) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058426-25 Anti-LIX1 Antibody, Lix1 homolog (chicken) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIX1 Antibody

Anti-LIX1 Antibody

Lix1 homolog (chicken)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LIX1.

Alternative Gene Names

  • C5orf11

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Lix1 homolog (chicken)
Target Gene LIX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RRITKEFIMESVQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKT
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012988 (98%)
Mouse ENSMUSG00000047786 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.