CacheBy
Atlas Antibodies Anti-LIX1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LIX1L Antibody

상품 한눈에 보기

Human LIX1L 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 높은 종 간 보존성을 보임. 40% glycerol 기반의 안정한 PBS buffer에 보관.

카탈로그번호
HPA063598-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063598-100 Anti-LIX1L Antibody, limb and CNS expressed 1 like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063598-25 Anti-LIX1L Antibody, limb and CNS expressed 1 like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LIX1L Antibody

Anti-LIX1L Antibody

Target: limb and CNS expressed 1 like (LIX1L)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human LIX1L protein.


  • ICC (Immunocytochemistry)

Alternative Gene Names

  • MGC46719

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein limb and CNS expressed 1 like
Target Gene LIX1L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGALVVYEMVPSNSPPYV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000049288 100%
Rat ENSRNOG00000021213 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.